PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.22227s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 211aa    MW: 24154.9 Da    PI: 5.6229
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.22227s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.51.7e-291566253
               G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53
                          prlrW+++LH++Fv+aveqLGG+++AtPk +l+lm+v gLt++hvkSHLQk+
  Araha.22227s0001.1.p 15 PRLRWNSDLHNSFVQAVEQLGGENRATPKMVLQLMDVRGLTISHVKSHLQKH 66
                          8*************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-271166IPR009057Homeodomain-like
PROSITE profilePS5129410.8391171IPR017930Myb domain
SuperFamilySSF466893.23E-141370IPR009057Homeodomain-like
TIGRFAMsTIGR015576.8E-221566IPR006447Myb domain, plants
PfamPF002498.3E-61666IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MKNSIVRSYV RSKVPRLRWN SDLHNSFVQA VEQLGGENRA TPKMVLQLMD VRGLTISHVK  60
SHLQKHIQSL AEEILAKRSV RVTGQVTWWQ FQQYLHNYQR LRGNANFFQN HQRQEEEMYE  120
KIITFGESSN ETKEGPSDYF TCKSLYESSR APQNKTRDDD ENGDVVVAID DDGNVVGEHD  180
DDDVTLSLNS IKVSKEEEEL SLELTLGLKA *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0740214e-60AF074021.1 Arabidopsis thaliana BAC F4H6, chromosome IV, complete sequence.
GenBankAL1615014e-60AL161501.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 13.
GenBankCP0026874e-60CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010455747.11e-121PREDICTED: uncharacterized protein LOC104737306 isoform X1
TrEMBLA0A078E9A21e-109A0A078E9A2_BRANA; BnaA02g21100D protein
STRINGscaffold_603773.15e-55(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04580.12e-32G2-like family protein